DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and LOC3290497

DIOPT Version :10

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_551141.2 Gene:LOC3290497 / 3290497 VectorBaseID:AGAMI1_005151 Length:712 Species:Anopheles gambiae


Alignment Length:127 Identity:33/127 - (25%)
Similarity:50/127 - (39%) Gaps:35/127 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FTWTILGGLLALTSAAGLPQRPSSGY-----------------------------QEQDTARAFY 39
            |.:.|...::|: :.|||...|:..|                             .|:..|...|
Mosquito     3 FKFVIFAAVVAV-ARAGLIASPAVSYAAAPALVAAPVAKVAYAAAPIAKVAYAAQPEEYDANPHY 66

  Fly    40 SYGYRDENA----ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQA 96
            |:.|...:|    ::::..||.| ..:|.||.||.||..:||.|.|:...||.|....:|.|
Mosquito    67 SFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRREPLA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 18/47 (38%)
Smc <107..>387 CDD:440809
LOC3290497XP_551141.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.