DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and CG42367

DIOPT Version :10

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:98 Identity:29/98 - (29%)
Similarity:43/98 - (43%) Gaps:22/98 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILGGLLALTSAAGLPQRPSSGYQEQDTARAFYSYGY--RDENAA---------RAEYSSRDGTSR 61
            ||..|:|:  .||:   .:|...|...:.|.|.:.|  .|.::.         |.||.:      
  Fly    13 ILSALVAV--QAGI---IASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT------ 66

  Fly    62 GFYSYVDADGKLQTVRYEANGVQGFKAEASNQP 94
            |.||.||.||..:.|.|.|:.:.||.|:...:|
  Fly    67 GRYSLVDPDGHRRIVDYTADPLLGFNAQVRREP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 16/53 (30%)
Smc <107..>387 CDD:440809
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.