DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr31A

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:195 Identity:51/195 - (26%)
Similarity:82/195 - (42%) Gaps:48/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QDTARAFYSYGYRDE--NAARAEYSSRDGTS-RGFYSYVDADGKLQTVRYEANGVQGFKAEASNQ 93
            :.:.|..:|||..|.  ...:::..:|||.: .|.||.:||||..:||.|.|:.:.||.|....:
  Fly   130 ESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQRE 194

  Fly    94 P-------QAPVDKGKAPLPVTDTEEVQQARLNHLNALREAREKALATSLREEADRRQQ-EQIRN 150
            |       .|||....||.||.          .|:::...|...|......::....|| :|:. 
  Fly   195 PVVAARAVAAPVVSVSAPAPVP----------VHISSAPVASLPAPIYYPHQQVFAPQQIQQVA- 248

  Fly   151 NNEDQQSGEQSLTDEDAAILERVRAELSAMLADRQRELN---LPRNRDDREQREKQE--IRQDQR 210
                :|.||         ::|...|:        |.||.   :..|...::|:|:|:  ..|||:
  Fly   249 ----EQQGE---------VVESPVAQ--------QPELEPTPIDYNEGQQQQQEQQQQTYPQDQQ 292

  Fly   211  210
              Fly   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 18/45 (40%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.