DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Eb and Edg84A

DIOPT Version :9

Sequence 1:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster


Alignment Length:118 Identity:39/118 - (33%)
Similarity:54/118 - (45%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LICTTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGY------MAPLYSKHETRTVDGVI 66
            |..|.||||      :.||.|...:.|:..: |.|.||::.|      ...:.|:.|:|..| |:
  Fly     7 LFVTLIGLA------QAGPLPAKSSGSEDTY-DSHPQYSFNYDVQDPETGDVKSQSESRDGD-VV 63

  Fly    67 RGTFSHIDANGETQTVDYVA-DAEGFH-VTSNLP--------NQQANQETPEV 109
            .|.:|..||:|..:||||.| |..||: |....|        ..||....|:|
  Fly    64 HGQYSVNDADGYRRTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKV 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 18/52 (35%)
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:278791 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.