DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Eb and Cpr76Bb

DIOPT Version :9

Sequence 1:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:112 Identity:30/112 - (26%)
Similarity:41/112 - (36%) Gaps:41/112 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SPTLEYGPPPTS-------DTISQY-----HHQDEHGQYAYGYMAPLYSKHET------------ 59
            |.|...||...|       |.:|.|     |.....|...|||.   |.|||.            
  Fly    31 SVTKHEGPVHKSLGYGYDHDVVSAYGGIYGHGYPSVGHSGYGYG---YDKHEPHHYPKYQFDYGV 92

  Fly    60 ------------RTVDG-VIRGTFSHIDANGETQTVDYVA-DAEGFH 92
                        .|.|| .::|::|..:::|.|:.|:|.| |..||:
  Fly    93 KDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 18/71 (25%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 11/51 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.