Sequence 1: | NP_648883.1 | Gene: | Cpr72Eb / 39815 | FlyBaseID: | FBgn0036618 | Length: | 217 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648882.1 | Gene: | Cpr72Ea / 39814 | FlyBaseID: | FBgn0036617 | Length: | 341 | Species: | Drosophila melanogaster |
Alignment Length: | 331 | Identity: | 83/331 - (25%) |
---|---|---|---|
Similarity: | 114/331 - (34%) | Gaps: | 158/331 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 TTIGLAVGSPTLEYGPPPTSDTISQYHHQDEHGQYAYGYMAPLYSKHETRTVDGVIRGTFSHIDA 75
Fly 76 NGETQTVDYVADAEGFHV-TSNLPNQQANQETPE------------------------------- 108
Fly 109 -----------VAALRTQHLEA-----HNQAKLRLA----------------------------- 128
Fly 129 -------------------------------------------------------------GDYS 132
Fly 133 VGPQPVRDTPEVAAAKVAFFKRFEAEKLRNKLLAEKKVLV-----IPNPTPIAVRSQPIYVYQPT 192
Fly 193 TTGFVY 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr72Eb | NP_648883.1 | Chitin_bind_4 | 45..91 | CDD:278791 | 26/45 (58%) |
Cpr72Ea | NP_648882.1 | Chitin_bind_4 | 49..95 | CDD:278791 | 26/45 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45469022 | |
Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I17890 |
eggNOG | 1 | 0.900 | - | - | E1_2ADEX | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0014381 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12236 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.840 |