DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Eb and Cpr66Cb

DIOPT Version :10

Sequence 1:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster


Alignment Length:106 Identity:32/106 - (30%)
Similarity:47/106 - (44%) Gaps:30/106 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LEYGPP--PTSDTISQYHHQDEHGQYAYGYMAPLY---------------SKHETRTVDGVIRGT 69
            ||:..|  .|.::    |..|||..|   |..|.|               |:||||..| .::|.
  Fly    62 LEHAEPHYETHES----HGHDEHVDY---YAPPKYAFKYGVNDFHTGDVKSQHETRDGD-TVKGQ 118

  Fly    70 FSHIDANGETQTVDYVADA-EGF----HVTSNLPNQQANQE 105
            :|.::.:|..:||||.||. .||    |.|:.:.:.:...|
  Fly   119 YSLVEPDGSIRTVDYTADKHNGFNAVVHKTAPVHHHEELHE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:459790 19/61 (31%)
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:459790 16/52 (31%)

Return to query results.
Submit another query.