DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Eb and Cpr66Cb

DIOPT Version :9

Sequence 1:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_648209.1 Gene:Cpr66Cb / 38940 FlyBaseID:FBgn0035875 Length:162 Species:Drosophila melanogaster


Alignment Length:106 Identity:32/106 - (30%)
Similarity:47/106 - (44%) Gaps:30/106 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LEYGPP--PTSDTISQYHHQDEHGQYAYGYMAPLY---------------SKHETRTVDGVIRGT 69
            ||:..|  .|.::    |..|||..|   |..|.|               |:||||..| .::|.
  Fly    62 LEHAEPHYETHES----HGHDEHVDY---YAPPKYAFKYGVNDFHTGDVKSQHETRDGD-TVKGQ 118

  Fly    70 FSHIDANGETQTVDYVADA-EGF----HVTSNLPNQQANQE 105
            :|.::.:|..:||||.||. .||    |.|:.:.:.:...|
  Fly   119 YSLVEPDGSIRTVDYTADKHNGFNAVVHKTAPVHHHEELHE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 19/61 (31%)
Cpr66CbNP_648209.1 Chitin_bind_4 89..141 CDD:395303 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.