DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Eb and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:102 Identity:31/102 - (30%)
Similarity:47/102 - (46%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYFLNLCLICTTIGLAVGSPTLEYGPP---PTSDTISQYHHQDEHGQYAYGY------MAPLYSK 56
            |..:.:.|||..:..|:....|....|   |.:..:      |.|.|||:.|      .....|:
  Fly     1 MALIKITLICCALIAAIECALLPAAVPVGVPLNTEV------DPHPQYAFAYNVQDALTGDSKSQ 59

  Fly    57 HETRTVDGVIRGTFSHIDANGETQTVDYVAD-AEGFH 92
            .|.|..| |::|::|.:||:|..:||.|.|| ..||:
  Fly    60 QEVRDGD-VVKGSYSVVDADGSLRTVFYTADPINGFN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:459790 18/52 (35%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 18/52 (35%)

Return to query results.
Submit another query.