DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Eb and Cpr50Ca

DIOPT Version :9

Sequence 1:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:99 Identity:21/99 - (21%)
Similarity:31/99 - (31%) Gaps:42/99 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YHHQDEH------------------------------------GQYAYGY------MAPLYSKHE 58
            :|||.:|                                    .:|.:||      ....:...:
  Fly   706 HHHQQQHHGLVATVLPAELDSDKGVNGLHFVNSDEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQ 770

  Fly    59 TRTVDGVIRGTFSHIDANGETQTVDYVADAEGFH 92
            .|.:.||.||.:..:..:|..|.|.|.||..|||
  Fly   771 NRDLHGVTRGQYHILLPDGRIQNVIYHADDTGFH 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 14/51 (27%)
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.