DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Eb and Y39B6A.10

DIOPT Version :9

Sequence 1:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_741688.1 Gene:Y39B6A.10 / 180258 WormBaseID:WBGene00012672 Length:256 Species:Caenorhabditis elegans


Alignment Length:169 Identity:34/169 - (20%)
Similarity:58/169 - (34%) Gaps:53/169 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DEHGQYAYGYMAPLYSKHETRTVDGVIRGTFSHIDANGETQTVDYVADAEGFHVTSNLPNQQANQ 104
            ||..|.:..:        |.:::.|.::..  .|..|.|...:||:|..:...|...|.:....|
 Worm    94 DESQQISTNF--------EFQSISGKLKQL--KITENLEKSIIDYLALCQKLPVLVTLRDVTEFQ 148

  Fly   105 ------ETPEVAALRTQH----------LEAHNQAKLRLAGDYSVGPQPVRDTPEVAAAKVAFFK 153
                  |.|    ||.|:          .|...|...::.|:.:.|...:    ....||...::
 Worm   149 IFAQKSEVP----LRIQYKKRKLKILRISENLKQFFTKMLGNSTSGTHLI----YFFGAKSKIYE 205

  Fly   154 RFE----------------AEKLRNKLLAEK---KVLVI 173
            .||                ||...|:.:.||   ::||:
 Worm   206 NFENLTENRRFCAEIKEIYAENGENRGILEKSAEEILVV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 8/45 (18%)
Y39B6A.10NP_741688.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2ADEX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.