DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:179 Identity:50/179 - (27%)
Similarity:72/179 - (40%) Gaps:26/179 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YPYAYTAEGSAVFTPTQRQYIAKDELGQY--SYGYSEPLS--SKQETRTLDG-ITQGYYSYRDAA 80
            |.:|..|....|......:|   |...||  |||..:.|:  :|.:....|| :.:|.||..||.
  Fly    37 YAHAPVAVAQKVVVKAAEEY---DPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDAD 98

  Fly    81 GKLQTVNYVADN-KGFHVAATNLPKAKVPQESLEFSP--RSASHPVDHH----VEHHAEVSHAVV 138
            |..:.|.|.||. .||:......|..|    ::..:|  ::.:.||..:    |.|:|..:....
  Fly    99 GYKRIVQYTADPINGFNAVVNREPLVK----AVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKT 159

  Fly   139 QHPVGHH--PIEVPHHHTVVESGRSAHPDGH--HPVEHHEHRVAVAQHP 183
            ..||.|:  |..|   .||......|.|..:  :....|....|||.||
  Fly   160 VAPVAHYAAPAVV---KTVAPVAHYAAPAAYATYAAPTHYAAPAVAYHP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 19/52 (37%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 18/51 (35%)

Return to query results.
Submit another query.