DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr72Ec

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster


Alignment Length:60 Identity:29/60 - (48%)
Similarity:41/60 - (68%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YSYGYSEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKV 107
            |||||.:..:::.|..:.||.::|:|||.||.||||||.|.|:. :||...|:|.|:|.|
  Fly    39 YSYGYRDENAARAEYSSRDGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 22/46 (48%)
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 22/42 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469023
Domainoid 1 1.000 58 1.000 Domainoid score I17890
eggNOG 1 0.900 - - E1_2ADEX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.