DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:100 Identity:29/100 - (28%)
Similarity:43/100 - (43%) Gaps:27/100 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RQYIAKDEL---GQYSYGYSEPLSSKQETRTLDGI------TQGYY-----SYRDAAGKLQTVNY 88
            |:|  |.:|   |.|:|.|          :|.:||      ..|||     :|....|:|..:.|
  Fly    29 REY--KSDLKEDGSYAYQY----------QTSNGIAGQESGVGGYYASGSNAYYAPDGQLIQLTY 81

  Fly    89 VADNKGFHVAATNLP-KAKVPQESLEFSPRSASHP 122
            .||:.|:|.|..:|| ...:|...|:......:||
  Fly    82 TADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHP 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 15/57 (26%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 15/56 (27%)

Return to query results.
Submit another query.