DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:36 Identity:11/36 - (30%)
Similarity:20/36 - (55%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ITQGYYSYRDAAGKLQTVNYVADNKGFHVAATNLPK 104
            :.:|.|:|....|:..::.|:||..||.....:||:
  Fly    70 VVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 7/25 (28%)
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 7/25 (28%)

Return to query results.
Submit another query.