DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr62Bb

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster


Alignment Length:283 Identity:63/283 - (22%)
Similarity:95/283 - (33%) Gaps:113/283 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLGSLSLAH-GLAL-YYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSE----PLSSKQET 63
            |.|..|:::|. |.|| ||.:...|                     ::||.::    .:.|:.||
  Fly    12 LALFASVAVARPGYALDYYDHPKYA---------------------FNYGVADHSTGDVKSQHET 55

  Fly    64 RTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVPQESLEFSPRSASHPVDHH 126
            |  || :.:|.||..:..|.::||:|.||: .||:...|.                  |.|..| 
  Fly    56 R--DGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTK------------------SGPTVH- 99

  Fly   127 VEHHAEVSHAVVQHP-VGHHPIEVPHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHPVE 190
                   :.|||..| |.|.|:                      :.|:|.:|.....||.|.|:.
  Fly   100 -------AQAVVASPIVAHKPV----------------------LTHYEPQVVKHVAPVAHAPLV 135

  Fly   191 VPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHSIE 255
            |            |.|..:  |..|..|.|.|       |:...:.......|           :
  Fly   136 V------------ASPAPY--VAKHYAPAAAA-------PIHYDYDDGYYNQG-----------Q 168

  Fly   256 HHEHPVSGSDPSGSHGGHSQLPH 278
            .:|: :...|....|.||...|:
  Fly   169 QYEY-IPQYDQYSGHYGHYASPY 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 17/51 (33%)
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.