DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Lcp2

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:100 Identity:22/100 - (22%)
Similarity:36/100 - (36%) Gaps:27/100 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YSEPLSSKQETR---------TLDGITQ-----------GYYSYRDAAGKLQTVNYVADNKGFHV 97
            :::.||...:.|         |.:||.|           |.:.:....|:...|.|||:..|:..
  Fly    27 HADVLSRSDDVRADGFDSSLHTSNGIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQP 91

  Fly    98 AATNLPKAKVPQES-------LEFSPRSASHPVDH 125
            :...:|......|:       ||..|.:..||..|
  Fly    92 SGAWIPTPPPIPEAIARAVAWLESHPPAPEHPRHH 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 13/61 (21%)
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 10/46 (22%)

Return to query results.
Submit another query.