DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr35B

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:191 Identity:55/191 - (28%)
Similarity:71/191 - (37%) Gaps:59/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DELGQYSYGY------SEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVAD-NKGFHVAATN 101
            |...:|.:.|      :..:.|:.|:|....:| |:|...||.|..:||:|.|| :|||      
  Fly    67 DSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVT-GHYELIDADGHKRTVHYTADKHKGF------ 124

  Fly   102 LPKAKVPQESLEFSPRSASHPVDHH-VEHHAEVSHAVVQHPVGHHPIEVPHHHTVVESGRSAHPD 165
              :|.|.:|.|.          ||| .|||..          ||...|..|......|.:|.|..
  Fly   125 --EAHVHREKLH----------DHHQAEHHGH----------GHSGYEGGHVEFEEHSSQSGHDY 167

  Fly   166 GHHPVEH-HEHRVAVAQHPVGH----HPVEVPHHHTVVETGRSAHPDGH-HPVEH---HEH 217
            ||...|| |.|     .|..||    |...:...|        .|..|| |..:|   |.|
  Fly   168 GHGHEEHGHGH-----GHGHGHGSSSHSYSLKQEH--------GHGHGHSHGQDHGFEHGH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 17/52 (33%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.