DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr23B

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:54/134 - (40%) Gaps:34/134 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLGSLSLAHGLALYYPYAYTA----EGSAVFTPTQRQ-------------YIAKDELGQ----- 48
            ||..:.|.|:..::..|.....    :.|.|.:.||:|             .:....|.|     
  Fly    86 LLQNAASAANAESVLLPSPLPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPE 150

  Fly    49 ------YSYGYSEPLSS----KQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATN 101
                  ||:.|:...:|    |:.:.|.|| :.:|:||..|..|..:||.|.||: .||:.....
  Fly   151 VFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNR 215

  Fly   102 LPKA 105
            :|.|
  Fly   216 VPYA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 18/51 (35%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.