DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and CG42367

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:71 Identity:22/71 - (30%)
Similarity:30/71 - (42%) Gaps:12/71 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DEL----GQYSYGY------SEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADN-KGFHV 97
            |||    .||.:.|      |..:..:.|.|..:.:| |.||..|..|..:.|:|.||. .||:.
  Fly    30 DELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT-GRYSLVDPDGHRRIVDYTADPLLGFNA 93

  Fly    98 AATNLP 103
            .....|
  Fly    94 QVRREP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 15/52 (29%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.