DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Y39B6A.10

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_741688.1 Gene:Y39B6A.10 / 180258 WormBaseID:WBGene00012672 Length:256 Species:Caenorhabditis elegans


Alignment Length:89 Identity:16/89 - (17%)
Similarity:32/89 - (35%) Gaps:25/89 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 EVPHSIEHHEHPVS----------------GSDPSGSH-----GGHSQLPHPVSDTAE----VAA 288
            |||..|::.:..:.                |:..||:|     |..|::.....:..|    .|.
 Worm   155 EVPLRIQYKKRKLKILRISENLKQFFTKMLGNSTSGTHLIYFFGAKSKIYENFENLTENRRFCAE 219

  Fly   289 AKSLHLQRVHDEGVRNQVLAKIPV 312
            .|.::.:...:.|:..:...:|.|
 Worm   220 IKEIYAENGENRGILEKSAEEILV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791
Y39B6A.10NP_741688.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2ADEX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.