DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and Tppp

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_878259.1 Gene:Tppp / 72948 MGIID:1920198 Length:218 Species:Mus musculus


Alignment Length:203 Identity:82/203 - (40%)
Similarity:115/203 - (56%) Gaps:21/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AANGSPSPAPTPEVPATELAQLALEDE---------PKVS-FSDQFKAFSKFGDSKSDGKLITLS 60
            |||.:|..:|..  ||....:|:||.|         |::| ..:.|:.|:..||:::.||.:...
Mouse    11 AANKTPPKSPGD--PARAAKRLSLESEGANEGATAAPELSALEEAFRRFAVHGDTRATGKEMHGK 73

  Fly    61 QSDKWMKQAKVID-KKITTTDTGIHFKKFKAMK---ISLSDYNKFLDDLAKTK-KVELSE--IKQ 118
            ...|..|...||| |.:|.||..|.|.|.|...   |:...:.:.|::|||.: |.:.||  :::
Mouse    74 NWSKLCKDCHVIDGKNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVRE 138

  Fly   119 --KLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFDASGKGKGIAGRRNVVDGSGYVSG 181
              :|....||.:..|:...::..|.|||||||:|||||||||.||||||.|||.::||.||||.|
Mouse   139 VHRLIEGRAPVISGVTKAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPG 203

  Fly   182 YQHKDTYD 189
            |:|..|||
Mouse   204 YKHAGTYD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 65/153 (42%)
TpppNP_878259.1 Mediates interaction with LIMK1. /evidence=ECO:0000250|UniProtKB:O94811 1..115 33/105 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 11/36 (31%)
p25-alpha 51..206 CDD:368481 65/154 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..192 22/25 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834634
Domainoid 1 1.000 116 1.000 Domainoid score I5926
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H21389
Inparanoid 1 1.050 122 1.000 Inparanoid score I4733
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52260
OrthoDB 1 1.010 - - D1317210at2759
OrthoFinder 1 1.000 - - FOG0002323
OrthoInspector 1 1.000 - - otm44062
orthoMCL 1 0.900 - - OOG6_102553
Panther 1 1.100 - - O PTHR12932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.