DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and TPPP3

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_057048.2 Gene:TPPP3 / 51673 HGNCID:24162 Length:176 Species:Homo sapiens


Alignment Length:179 Identity:76/179 - (42%)
Similarity:102/179 - (56%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ATELAQLALEDEPKVSFSDQFKAFSKFGDSKSDGKLITLSQSDKWMKQAKVID-KKITTTDTGIH 84
            :|::|.|          .:.|:.|:..||.|:.|:.:......|..|..||.| |.:|.||..|.
Human     4 STDMAGL----------EESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIV 58

  Fly    85 FKKFK---AMKISLSDYNKFLDDLA------KTKKVELSEIKQKLASCGAPGVVSVSAGKAAAAV 140
            |.|.|   |..|:..::.|.|::||      |:|:.....|.|.:|. ..|..|.|:..|...||
Human    59 FSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAG-KEPANVGVTKAKTGGAV 122

  Fly   141 DRLTDTSKYTGSHKERFDASGKGKGIAGRRNVVDGSGYVSGYQHKDTYD 189
            |||||||:||||||||||.||||||||||::::|.|||||.|::..|||
Human   123 DRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 70/154 (45%)
TPPP3NP_057048.2 p25-alpha 11..166 CDD:310253 70/155 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..152 18/19 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144505
Domainoid 1 1.000 114 1.000 Domainoid score I6070
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4755
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52260
OrthoDB 1 1.010 - - D1317210at2759
OrthoFinder 1 1.000 - - FOG0002323
OrthoInspector 1 1.000 - - otm42009
orthoMCL 1 0.900 - - OOG6_102553
Panther 1 1.100 - - LDO PTHR12932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2904
SonicParanoid 1 1.000 - - X1531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.