DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and tppp3

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_958492.2 Gene:tppp3 / 393825 ZFINID:ZDB-GENE-040426-1909 Length:177 Species:Danio rerio


Alignment Length:178 Identity:73/178 - (41%)
Similarity:97/178 - (54%) Gaps:19/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ATELAQLALEDEPKVSFSDQFKAFSKFGDSKSDGKLITLSQSDKWMKQAKVID-KKITTTDTGIH 84
            :|::.||.          :.||.|:..||:|:.||.:......|..|..|||| |.:|:||..|.
Zfish     4 STDMDQLL----------NSFKKFAVHGDTKATGKELNGKNWAKLCKDCKVIDGKNVTSTDVDIV 58

  Fly    85 FKKFKAMK---ISLSDYNKFLDDLAKTK-----KVELSEIKQKLASCGAPGVVSVSAGKAAAAVD 141
            |.|.||..   |:..::.|.|::||..:     |.|..|...||.....|..:.|:.....||||
Zfish    59 FTKVKAKTSRVITYEEFQKALEELAPKRFKGQSKEEALESIYKLIEGKEPTNIGVTKVAKTAAVD 123

  Fly   142 RLTDTSKYTGSHKERFDASGKGKGIAGRRNVVDGSGYVSGYQHKDTYD 189
            |||||||||||||||||.:|||||..||..:|:.:|||..|::...||
Zfish   124 RLTDTSKYTGSHKERFDETGKGKGKGGREEIVEHTGYVGAYKNAGKYD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 68/153 (44%)
tppp3NP_958492.2 p25-alpha 13..171 CDD:283231 68/157 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577630
Domainoid 1 1.000 111 1.000 Domainoid score I6182
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4805
OMA 1 1.010 - - QHG52260
OrthoDB 1 1.010 - - D1317210at2759
OrthoFinder 1 1.000 - - FOG0002323
OrthoInspector 1 1.000 - - otm26422
orthoMCL 1 0.900 - - OOG6_102553
Panther 1 1.100 - - O PTHR12932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2904
SonicParanoid 1 1.000 - - X1531
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.