DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and CG6709

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001097567.1 Gene:CG6709 / 39166 FlyBaseID:FBgn0036056 Length:117 Species:Drosophila melanogaster


Alignment Length:108 Identity:34/108 - (31%)
Similarity:56/108 - (51%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EDEPKVSFSDQ-FKAFSKFGDSKSDGK-----LITLSQSDKWMKQAKVIDKKITTTDTGIHFKKF 88
            ||:||....|. |..:|.|....:|.:     .|.|||.|.|::|||::...||.|.||:.:.::
  Fly     5 EDKPKKHTLDSLFLVYSNFQVIPTDIENEYFDSILLSQLDAWLEQAKLMPNPITRTQTGLIYMRY 69

  Fly    89 KAMKISLSDYNKFLDDLAKTKKVELSEIKQKLASCGAPGVVSV 131
            |..::...|:.:.|::||....:.:.|:||.:...|.|....|
  Fly    70 KKWRLEYEDFLEVLNNLASDNNLAIDEMKQIMIDAGVPNGADV 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 30/99 (30%)
CG6709NP_001097567.1 p25-alpha 41..>107 CDD:147609 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.