DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and Tppp

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001101931.1 Gene:Tppp / 361466 RGDID:1310121 Length:218 Species:Rattus norvegicus


Alignment Length:203 Identity:82/203 - (40%)
Similarity:115/203 - (56%) Gaps:21/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AANGSPSPAPTPEVPATELAQLALEDE---------PKVS-FSDQFKAFSKFGDSKSDGKLITLS 60
            |||.:|..:|..  ||....:|:||.|         |::| ..:.|:.|:..||:::.||.:...
  Rat    11 AANKTPPKSPGD--PAKAAKRLSLESEGANEGAAAAPELSALEEAFRRFAVHGDTRATGKEMHGK 73

  Fly    61 QSDKWMKQAKVID-KKITTTDTGIHFKKFKAMK---ISLSDYNKFLDDLAKTK-KVELSE--IKQ 118
            ...|..|...||| |.:|.||..|.|.|.|...   |:...:.:.|::|||.: |.:.||  :::
  Rat    74 NWSKLCKDCHVIDGKNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVRE 138

  Fly   119 --KLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFDASGKGKGIAGRRNVVDGSGYVSG 181
              :|....||.:..|:...::..|.|||||||:|||||||||.||||||.|||.::||.||||.|
  Rat   139 VHRLIEGRAPVISGVTKAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPG 203

  Fly   182 YQHKDTYD 189
            |:|..|||
  Rat   204 YKHAGTYD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 65/153 (42%)
TpppNP_001101931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 11/35 (31%)
Mediates interaction with LIMK1. /evidence=ECO:0000250|UniProtKB:O94811 2..115 33/105 (31%)
p25-alpha 51..206 CDD:368481 65/154 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..192 23/26 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338212
Domainoid 1 1.000 118 1.000 Domainoid score I5706
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H21389
Inparanoid 1 1.050 124 1.000 Inparanoid score I4622
OMA 1 1.010 - - QHG52260
OrthoDB 1 1.010 - - D1317210at2759
OrthoFinder 1 1.000 - - FOG0002323
OrthoInspector 1 1.000 - - otm46152
orthoMCL 1 0.900 - - OOG6_102553
Panther 1 1.100 - - O PTHR12932
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1531
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.