DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and tppp-1

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_491219.1 Gene:tppp-1 / 171948 WormBaseID:WBGene00016321 Length:180 Species:Caenorhabditis elegans


Alignment Length:164 Identity:70/164 - (42%)
Similarity:93/164 - (56%) Gaps:13/164 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QFKAFSKFGDSKSDGKLITLSQSDKWMKQAKVIDKK-ITTTDTGIHFKKFKA--MKISLSDYNKF 101
            ::.||:|||.:.:..  :|....|||:|.|.|:|.| ||.|.|||.|.|...  .|.:..:..|.
 Worm    17 RWDAFTKFGAATATE--MTGKNFDKWLKDAGVLDNKAITGTMTGIAFSKVTGPKKKATFDETKKV 79

  Fly   102 L----DDLAKTKKV----ELSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFD 158
            |    :|.|:..|.    ||..|.:|||...||.|...:...||....||||.:||||:||||||
 Worm    80 LAFVAEDRARQSKKPIQDELDAITEKLAKLEAPSVGGAAKANAAGVYSRLTDHTKYTGAHKERFD 144

  Fly   159 ASGKGKGIAGRRNVVDGSGYVSGYQHKDTYDNAH 192
            |.|||||.:||.:..:.:|||..|::||:||..|
 Worm   145 AEGKGKGKSGRADTTENTGYVGAYKNKDSYDKTH 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 65/154 (42%)
tppp-1NP_491219.1 p25-alpha 18..175 CDD:283231 67/158 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158301
Domainoid 1 1.000 102 1.000 Domainoid score I4300
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I3410
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52260
OrthoDB 1 1.010 - - D1317210at2759
OrthoFinder 1 1.000 - - FOG0002323
OrthoInspector 1 1.000 - - oto19055
orthoMCL 1 0.900 - - OOG6_102553
Panther 1 1.100 - - LDO PTHR12932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2904
SonicParanoid 1 1.000 - - X1531
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.