DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and TPPP2

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_776245.2 Gene:TPPP2 / 122664 HGNCID:19293 Length:170 Species:Homo sapiens


Alignment Length:166 Identity:68/166 - (40%)
Similarity:85/166 - (51%) Gaps:25/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FKAFSKFGDSKSDGKLITLSQSDKWMKQAKVID-KKITTTDTGIHFKKFKAMKISLSDYNKFLDD 104
            |..|:.||:|.|.|..:......|..|...::| |.:|:||..|.|.|.||.......:.:|   
Human     9 FHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQF--- 70

  Fly   105 LAKTKKVELSEIKQKLASCGAPGVV--------------SVSAGKA--AAAVDRLTDTSKYTGSH 153
                 |..:.|:.||.....:|..|              :..|.||  ..|||||||||||||:|
Human    71 -----KEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTH 130

  Fly   154 KERFDASGKGKGIAGRRNVVDGSGYVSGYQHKDTYD 189
            |||||.||||||||||..:.|.:||||||:...|||
Human   131 KERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 65/159 (41%)
TPPP2NP_776245.2 p25-alpha 6..161 CDD:310253 65/159 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..170 28/40 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144506
Domainoid 1 1.000 114 1.000 Domainoid score I6070
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4755
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52260
OrthoDB 1 1.010 - - D1317210at2759
OrthoFinder 1 1.000 - - FOG0002323
OrthoInspector 1 1.000 - - otm42009
orthoMCL 1 0.900 - - OOG6_102553
Panther 1 1.100 - - O PTHR12932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2904
SonicParanoid 1 1.000 - - X1531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.