DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ringer and tppp3

DIOPT Version :9

Sequence 1:NP_001246792.1 Gene:ringer / 39813 FlyBaseID:FBgn0266417 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001096466.1 Gene:tppp3 / 100125085 XenbaseID:XB-GENE-955234 Length:176 Species:Xenopus tropicalis


Alignment Length:169 Identity:72/169 - (42%)
Similarity:95/169 - (56%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EDEPKVSFSDQFKAFSKFGDSKSDGKLITLSQSDKWMKQAKVID-KKITTTDTGIHFKKFK---A 90
            |:....|..:.|:.|:.:||:|:.|:.:|.....|..|..|||| |.:|.||..|.|.|.|   |
 Frog     3 ENSDLTSLEESFRKFAIYGDTKATGQEMTGKNWAKLCKDCKVIDGKSVTGTDVDIVFSKVKGKSA 67

  Fly    91 MKISLSDYNKFLDDLAKTK-----KVELSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYT 150
            ..|:..::.|.|::|:..:     |.|..|...||.....|....::...|..||||||||||||
 Frog    68 RVITCEEFKKALEELSGKRFKGKSKEEAYEAICKLVVGKEPVSAGITKPAATGAVDRLTDTSKYT 132

  Fly   151 GSHKERFDASGKGKGIAGRRNVVDGSGYVSGYQHKDTYD 189
            ||||||||.||||||..||..:|:.:||||.|:...|||
 Frog   133 GSHKERFDESGKGKGKGGRETIVENTGYVSSYKLAGTYD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ringerNP_001246792.1 p25-alpha 39..184 CDD:368481 67/153 (44%)
tppp3NP_001096466.1 p25-alpha 11..165 CDD:368481 66/153 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..152 22/25 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6242
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4643
OMA 1 1.010 - - QHG52260
OrthoDB 1 1.010 - - D1317210at2759
OrthoFinder 1 1.000 - - FOG0002323
OrthoInspector 1 1.000 - - oto105021
Panther 1 1.100 - - LDO PTHR12932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2904
SonicParanoid 1 1.000 - - X1531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.