DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdh and AYR1

DIOPT Version :9

Sequence 1:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_012142.3 Gene:AYR1 / 854682 SGDID:S000001386 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:71/272 - (26%)
Similarity:108/272 - (39%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SQTKMSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIK 78
            ||.|     |.|||||.:||||.:|:|:|...|   ..:......||...:|.......|:...|
Yeast     6 SQPK-----KIAVVTGASGGIGYEVTKELARNG---YLVYACARRLEPMAQLAIQFGNDSIKPYK 62

  Fly    79 MDVANKKGVEATYEEIAKTF----------GNIDIVVNVAG---IF-----NDKDVQRTLLVNLG 125
            :|::..       |||. ||          |.:|::.|.||   .|     .|..|::...||:.
Yeast    63 LDISKP-------EEIV-TFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVF 119

  Fly   126 GIINSTLSALPYMGKDNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRS 190
            |.||.......::.|   .||.||.. .|:.|:.......:|.|:||.|..:.|.|..|  .:..
Yeast   120 GHINMCRELSEFLIK---AKGTIVFT-GSLAGVVSFPFGSIYSASKAAIHQYARGLHLE--MKPF 178

  Fly   191 GIKFVTVCPGATMTDMFTNFTEKIIFPETSDETY----------RILDRLNKQSAAD--VSRCIL 243
            .::.:....|...||:    .:|...||||...:          :.:.:.||...||  ..:.:.
Yeast   179 NVRVINAITGGVATDI----ADKRPLPETSIYNFPEGREAFNSRKTMAKDNKPMPADAYAKQLVK 239

  Fly   244 NVLEKDKNGAVY 255
            ::|.......||
Yeast   240 DILSTSDPVDVY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 68/263 (26%)
adh_short 23..214 CDD:278532 56/208 (27%)
AYR1NP_012142.3 17beta-HSD-like_SDR_c 10..256 CDD:187632 68/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.