DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdh and Hsd17b14

DIOPT Version :9

Sequence 1:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001178040.1 Gene:Hsd17b14 / 691018 RGDID:1588673 Length:270 Species:Rattus norvegicus


Alignment Length:218 Identity:58/218 - (26%)
Similarity:94/218 - (43%) Gaps:25/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIKMDVANK 84
            :.||..|||||:.|||..:.:..:.:| |:|...|..:.....|:    ......:.|..||..:
  Rat     7 YSGKVVVVTGGSRGIGAAIVRAFVDSG-AQVVFCDKDEAGGRAVE----QELLGTVFIPGDVTQE 66

  Fly    85 KGVEATYEEIAKTFGNIDIVVNVAGIF---------NDKDVQRTLLVNLGGIINSTLSALPYMGK 140
            ..::....|....||::|.|||.||..         :.:..::.|..||.|.......|||::.|
  Rat    67 GDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAYTLIKLALPHLRK 131

  Fly   141 DNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTD 205
            ..|.    ::|:||:||.........|.|||..:...|:.||.::  .|.|::...:.||...|.
  Rat   132 SKGN----IINISSLVGAIGQSQALTYVATKGAVTAMTKALALDE--SRYGVRVNCISPGNIWTP 190

  Fly   206 MFTNFTEKIIFPETSDETYRILD 228
            ::..     :...|||....||:
  Rat   191 LWQE-----LAAATSDPRATILE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 57/215 (27%)
adh_short 23..214 CDD:278532 52/199 (26%)
Hsd17b14NP_001178040.1 NADB_Rossmann 1..256 CDD:419666 58/218 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.