DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdh and HPGD

DIOPT Version :9

Sequence 1:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_000851.2 Gene:HPGD / 3248 HGNCID:5154 Length:266 Species:Homo sapiens


Alignment Length:269 Identity:93/269 - (34%)
Similarity:147/269 - (54%) Gaps:19/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAA----HPTQSVMIIK 78
            |...||.|:|||.|.|||...::.||..| ||||::|.  |||..|:.:||    ...|..:.|:
Human     1 MHVNGKVALVTGAAQGIGRAFAEALLLKG-AKVALVDW--NLEAGVQCKAALDEQFEPQKTLFIQ 62

  Fly    79 MDVANKKGVEATYEEIAKTFGNIDIVVNVAGIFNDKDVQRTLLVNLGGIINSTLSALPYMGKDNG 143
            .|||:::.:..|:.::...||.:||:||.||:.|:|:.::||.:||..:|:.|...|.||.|.||
Human    63 CDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNG 127

  Fly   144 GKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTDMFT 208
            |:|||::||||:.||.|:...|||.|:|.||:.|||..|.......||::...:|||...|.:..
Human   128 GEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILE 192

  Fly   209 NFTEKIIFPETSDETYRILDRLNKQSAAD---VSRCILNVLEKDK-NGAVY-VIEGKRVY----- 263
            :..::....:..:....|.|.:......|   ::..::.::|.|. |||:. :...|.::     
Human   193 SIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYD 257

  Fly   264 --PLEIKPQ 270
              |.:.|.|
Human   258 TTPFQAKTQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 87/244 (36%)
adh_short 23..214 CDD:278532 79/194 (41%)
HPGDNP_000851.2 ADH_SDR_c_like 6..254 CDD:187584 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151370
Domainoid 1 1.000 138 1.000 Domainoid score I4841
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4450
Isobase 1 0.950 - 0.861353 Normalized mean entropy S2756
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40699
orthoMCL 1 0.900 - - OOG6_100916
Panther 1 1.100 - - O PTHR44229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.