DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdh and Y92H12BL.5

DIOPT Version :9

Sequence 1:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_740784.1 Gene:Y92H12BL.5 / 259365 WormBaseID:WBGene00022366 Length:150 Species:Caenorhabditis elegans


Alignment Length:139 Identity:29/139 - (20%)
Similarity:50/139 - (35%) Gaps:36/139 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RTLLVNLGGIINSTLSALPYMGKDNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRC-- 180
            |...:.:.|....||..|...||| |||                :::|      .|.|....|  
 Worm    26 RAAALCIKGTGKETLVLLVSGGKD-GGK----------------WVVP------GGGIEKDECAE 67

  Fly   181 -LANEKYYQRSGIKFVTVCPGATMTDMFTNFTEKIIFPETSDE--TYRILDRLNKQSAADVSRCI 242
             .|:.:..:.:|::...:.......|.......::...|.|:|  |:       :::.....|..
 Worm    68 EAAHRELMEEAGVRATILKKIGMFQDDVRKHRTQVFLMEVSEELQTW-------EENEYGRQRIW 125

  Fly   243 LNVLE-KDK 250
            :|||| |:|
 Worm   126 MNVLEGKEK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 29/139 (21%)
adh_short 23..214 CDD:278532 18/98 (18%)
Y92H12BL.5NP_740784.1 Nudix_Hydrolase_9 25..137 CDD:240024 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.