DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdh and R05D8.9

DIOPT Version :9

Sequence 1:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:225 Identity:65/225 - (28%)
Similarity:107/225 - (47%) Gaps:39/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIID-----LQDNLEEFVKLRAAHPTQSVMIIKM 79
            |.||.|:|||.:.||| :.:..|.|...|||.:..     |::..:|.  |::..|...|:.:..
 Worm     5 FSGKVALVTGSSNGIG-RAAAVLFAKDGAKVTVTGRNAERLEETRQEI--LKSGVPESHVLSVAT 66

  Fly    80 DVANKKGVEATYEEIAKTFGNIDIVVNVAG-IFN--------DKDV---QRTLLVNLGGIINSTL 132
            |:|.:||.:.......:.||.:||:||.|| .||        |:||   .:.:.:|:..::..|.
 Worm    67 DLAAEKGQDELVNSTIQKFGRLDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQINMRSVVTLTQ 131

  Fly   133 SALPYMGKDNGGKGGIVVNMSSVVG---LDPMFIIPVYGATKAGIINFTRCLANE--KYYQRSGI 192
            .|..::.|..|.    :||:||:.|   ..|.  :..|..:|:.:..||||.|.:  :|    |:
 Worm   132 KAKEHLVKAKGE----IVNVSSIAGTAHAQPG--VMYYAMSKSALDQFTRCAAIDLIQY----GV 186

  Fly   193 KFVTVCPGATMTDMFTNFTEKIIFPETSDE 222
            :..:|.||.    :.|.|.|.:..|..:.|
 Worm   187 RVNSVSPGG----VTTGFGEAMGMPSGAFE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 63/222 (28%)
adh_short 23..214 CDD:278532 61/212 (29%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 65/225 (29%)
NADB_Rossmann 5..266 CDD:304358 65/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861353 Normalized mean entropy S2756
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.