DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdh and Hpgd

DIOPT Version :9

Sequence 1:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_032304.2 Gene:Hpgd / 15446 MGIID:108085 Length:269 Species:Mus musculus


Alignment Length:271 Identity:96/271 - (35%)
Similarity:150/271 - (55%) Gaps:19/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAA----HPTQSVMIIK 78
            |...||.|:|||.|.|||...::.||..| ||||::|.  |||..||.:||    ...|..:.::
Mouse     1 MHVNGKVALVTGAAQGIGKAFAEALLLHG-AKVALVDW--NLEAGVKCKAALDEQFEPQKTLFVQ 62

  Fly    79 MDVANKKGVEATYEEIAKTFGNIDIVVNVAGIFNDKDVQRTLLVNLGGIINSTLSALPYMGKDNG 143
            .|||::|.:..|:.::...||.:||:||.||:.|:|:.::||.:||..:|:.|...|.||.|.||
Mouse    63 CDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNG 127

  Fly   144 GKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTDMFT 208
            |:|||::||||:.||.|:...|||.|:|.|||.|||..|......:||::...:|||...|.:..
Mouse   128 GEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILE 192

  Fly   209 NFTEKI---IFPETSDETYRILDRLNKQSAADVSRCILNVLEKDK-NGAVYVIEGKR-------- 261
            :..::.   .:.|..|:...::........:.::..::|::|.|. |||:..|...:        
Mouse   193 SIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQDYD 257

  Fly   262 VYPLEIKPQWT 272
            :.||.:|...|
Mouse   258 ISPLLVKAPLT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 90/243 (37%)
adh_short 23..214 CDD:278532 81/194 (42%)
HpgdNP_032304.2 ADH_SDR_c_like 6..254 CDD:187584 90/250 (36%)
adh_short 6..199 CDD:278532 81/195 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841505
Domainoid 1 1.000 142 1.000 Domainoid score I4666
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4369
Isobase 1 0.950 - 0.861353 Normalized mean entropy S2756
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42773
orthoMCL 1 0.900 - - OOG6_100916
Panther 1 1.100 - - O PTHR44229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.