DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs3 and GCP1

DIOPT Version :9

Sequence 1:NP_648880.1 Gene:Tcs3 / 39811 FlyBaseID:FBgn0283681 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_566039.1 Gene:GCP1 / 819135 AraportID:AT2G45270 Length:480 Species:Arabidopsis thaliana


Alignment Length:371 Identity:103/371 - (27%)
Similarity:166/371 - (44%) Gaps:48/371 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGIEGSANKIGIGIIR-DGKVLANVRRTYITPPGE------GFLPKETAKHHREAILGLVESSLK 62
            ||||.|.:.....::| :|::|:.|    |:...|      |..||:..:.|...|..:|:.:|.
plant    87 LGIETSCDDTAAAVVRGNGEILSQV----ISSQAELLVQYGGVAPKQAEEAHSRVIDKVVQDALD 147

  Fly    63 EAQLKSSDLDVICYTKGPGMAPPLLVGAIVARTLSLLWNIPLLGVNHCIGHIEMGRLITGAQN-P 126
            :|.|...||..:..|.|||::..|.||...||.::..:::|::||:|...|..:.||:....: |
plant   148 KANLTEKDLSAVAVTIGPGLSLCLRVGVRKARRVAGNFSLPIVGVHHMEAHALVARLVEQELSFP 212

  Fly   127 -TVLYVSGG-NTQVIAYSNKRYRIFGETIDIAVGNCLDRFARIIKLSNDPSPGYNIEQL-----A 184
             ..|.:||| |..|:|:...:|...|.|:|.|:|...|:.|:.:.|....|.|..:|:|     |
plant   213 FMALLISGGHNLLVLAHKLGQYTQLGTTVDDAIGEAFDKTAKWLGLDMHRSGGPAVEELALEGDA 277

  Fly   185 KSSNRYIKLPYVVKGMDVSFSGILSYIEDLAEPGKRQNKRKKPQEEEVN--NYSQADLCYSLQET 247
            ||....:.:.| .|..:.|::|:.:.:....|  .::...|.|.....|  ..::||:..|.|..
plant   278 KSVKFNVPMKY-HKDCNFSYAGLKTQVRLAIE--AKEIDAKCPVSSATNEDRRNRADIAASFQRV 339

  Fly   248 IFAMLVEITERAM-----AHCGSNEVLIVGGVGCNERLQEMMRIMCEERGGKLFATDERYCIDNG 307
            ....|.|..|||:     .......::|.|||..|:.::..:..:.|.:..||.......|.|||
plant   340 AVLHLEEKCERAIDWALELEPSIKHMVISGGVASNKYVRLRLNNIVENKNLKLVCPPPSLCTDNG 404

  Fly   308 LMIAHAGAEMFRSG-------------------TRMPFEESYVTQR 334
            :|:|..|.|.||.|                   .|.|..|.|...|
plant   405 VMVAWTGLEHFRVGRYDPPPPATEPEDYVYDLRPRWPLGEEYAKGR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs3NP_648880.1 PTZ00340 4..346 CDD:240369 103/371 (28%)
Carbam_trans_N 5..>108 CDD:304575 33/109 (30%)
Med2 <168..231 CDD:288112 15/67 (22%)
GCP1NP_566039.1 PRK09604 86..444 CDD:236585 100/363 (28%)
Carbam_trans_N 86..>192 CDD:304575 32/108 (30%)
NBD_sugar-kinase_HSP70_actin <330..396 CDD:302596 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100288
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.