DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs3 and OSGEPL1

DIOPT Version :9

Sequence 1:NP_648880.1 Gene:Tcs3 / 39811 FlyBaseID:FBgn0283681 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_024308807.1 Gene:OSGEPL1 / 64172 HGNCID:23075 Length:425 Species:Homo sapiens


Alignment Length:345 Identity:107/345 - (31%)
Similarity:164/345 - (47%) Gaps:38/345 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGIEGSANKIGIGIIRD-GKVLANV--RRTYITPPGEGFLPKETAKHHREAILGLVESSLKEAQL 66
            ||||.|.:.....::.: |.||...  .:|.:.....|.:|....:.|||.|..:|:.:|..:.:
Human    51 LGIETSCDDTAAAVVDETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGV 115

  Fly    67 KSSDLDVICYTKGPGMAPPLLVGAIVARTLSLLWNI--PLLGVNHCIGHIEMGRLITGAQNP-TV 128
            ..|||..|..|..||:|..|.||  ::.:|.|:..:  |.:.::|...|....||....:.| .|
Human   116 SPSDLSAIATTIKPGLALSLGVG--LSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLV 178

  Fly   129 LYVSGGNTQV-IAYSNKRYRIFGETIDIAVGNCLDRFARIIKLSNDP-----SPGYNIEQLAKSS 187
            |.:|||:..: :......:.:.|:::|||.|:.||:.||.:.|...|     |.|..||.|||..
Human   179 LLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQG 243

  Fly   188 NRY---IKLP-YVVKGMDVSFSGILSYIEDLAEPGKRQNKRKKPQEEEVNN----YSQADLCYSL 244
            ||:   ||.| :..|..|.||:| |.::.|       :...||.:||.:..    .|.||:..::
Human   244 NRFHFDIKPPLHHAKNCDFSFTG-LQHVTD-------KIIMKKEKEEGIEKGQILSSAADIAATV 300

  Fly   245 QETIFAMLVEITERAMAHC-------GSNEVLIV-GGVGCNERLQEMMRIMCEERGGKLFATDER 301
            |.|:...||:.|.||:..|       .:|.||:. |||..|..::..:.|:.......|.....|
Human   301 QHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPR 365

  Fly   302 YCIDNGLMIAHAGAEMFRSG 321
            .|.|||:|||..|.|..|:|
Human   366 LCTDNGIMIAWNGIERLRAG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs3NP_648880.1 PTZ00340 4..346 CDD:240369 107/345 (31%)
Carbam_trans_N 5..>108 CDD:304575 31/107 (29%)
Med2 <168..231 CDD:288112 24/71 (34%)
OSGEPL1XP_024308807.1 TsaD 49..388 CDD:223607 107/345 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100288
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.