DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs3 and CG14231

DIOPT Version :9

Sequence 1:NP_648880.1 Gene:Tcs3 / 39811 FlyBaseID:FBgn0283681 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001245765.1 Gene:CG14231 / 32982 FlyBaseID:FBgn0031060 Length:409 Species:Drosophila melanogaster


Alignment Length:359 Identity:107/359 - (29%)
Similarity:160/359 - (44%) Gaps:45/359 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGIEGSANKIGIGII-RDGKVLANV---RRTYITPPGEGFLPKETAKHHREAILGLVESSLKEAQ 65
            ||||.|.:..||.|: ..|:|:|||   ::.:.|..| |.:|......||..|....:..::.||
  Fly    28 LGIETSCDDTGIAIVDTTGRVIANVLESQQEFHTRYG-GIIPPRAQDLHRARIESAYQRCMEAAQ 91

  Fly    66 LKSSDLDVICYTKGPGMAPPLLVGAIVARTLSLLWNIPLLGVNHCIGHIEMGRLITGAQNP---- 126
            ||...|..|..|..||:...||||...||.|:.....|||.|:|...|....|:    ::|    
  Fly    92 LKPDQLTAIAVTTRPGLPLSLLVGVRFARHLARRLQKPLLPVHHMEAHALQARM----EHPEQIG 152

  Fly   127 ---TVLYVSGGNTQ-VIAYSNKRYRIFGETIDIAVGNCLDRFARIIKLSNDP-----SPGYNIE- 181
               ..|..|||:.| |:|....|..:.|:|:|.|.|...|:..|.::|...|     :.|..|| 
  Fly   153 YPFLCLLASGGHCQLVVANGPGRLTLLGQTLDDAPGEAFDKIGRRLRLHILPEYRLWNGGRAIEH 217

  Fly   182 --QLAKSSNRY-IKLPYV-VKGMDVSFSGILSYIEDLAEPGKRQNKRKKPQEEEVNNYSQADLCY 242
              |||.....| ..||.. .:..:.||:||.:  ........|:...:.|.:..::||  .|.|.
  Fly   218 AAQLASDPLAYEFPLPLAQQRNCNFSFAGIKN--NSFRAIRARERAERTPPDGVISNY--GDFCA 278

  Fly   243 SLQETIFAMLVEITERAMAHC--------GSNEVLIV--GGVGCNERLQEMMRIMCEERGGKLFA 297
            .|..::...|:..|:||:.:|        |.....:|  |||..|:.:...:..:..:.|.:.|.
  Fly   279 GLLRSVSRHLMHRTQRAIEYCLLPHRQLFGDTPPTLVMSGGVANNDAIYANIEHLAAQYGCRSFR 343

  Fly   298 TDERYCIDNGLMIAHAGAEMF----RSGTRMPFE 327
            ..:|||.|||:|||..|.|..    .:.||..::
  Fly   344 PSKRYCSDNGVMIAWHGVEQLLQDKEASTRYDYD 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs3NP_648880.1 PTZ00340 4..346 CDD:240369 107/359 (30%)
Carbam_trans_N 5..>108 CDD:304575 39/106 (37%)
Med2 <168..231 CDD:288112 17/72 (24%)
CG14231NP_001245765.1 T6A_TsaD_YgjD 27..365 CDD:274748 105/345 (30%)
Carbam_trans_N 27..>156 CDD:304575 44/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0533
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D88728at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100288
Panther 1 1.100 - - P PTHR11735
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.