DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs3 and C01G10.10

DIOPT Version :9

Sequence 1:NP_648880.1 Gene:Tcs3 / 39811 FlyBaseID:FBgn0283681 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_506713.1 Gene:C01G10.10 / 180015 WormBaseID:WBGene00007237 Length:421 Species:Caenorhabditis elegans


Alignment Length:353 Identity:92/353 - (26%)
Similarity:152/353 - (43%) Gaps:63/353 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VCALGIEGSANKIGIGIIRDGK-VLANVRRT--YITPPGEGFLPKETAKHHREAILGLVESSLKE 63
            |..||||.|.:...:.|:.:.: :|::.|.|  .|.....|..|...|..|||.:..|:|..|.:
 Worm    23 VKVLGIETSCDDTAVAIVNEKREILSSERYTERAIQRQQGGINPSVCALQHRENLPRLIEKCLND 87

  Fly    64 AQLKSSDLDVICYTKGPGMAPPLLVGAIVARTLSLLWNIPLLGVNHCIGHIEMGRLI-TGAQNP- 126
            |.....|||.:..|..||:...|..|...|...:....:||:.|:|...|.....|: ...:.| 
 Worm    88 AGTSPKDLDAVAVTVTPGLVIALKEGISAAIGFAKKHRLPLIPVHHMRAHALSILLVDDSVRFPF 152

  Fly   127 TVLYVSGGNTQV-IAYSNKRYRIFGETIDIAVGNCLDRFARIIKLSNDPSP------GYNIEQLA 184
            :.:.:|||:..: :|...::::::|:::..:.|.|:|:.||  :|.:..|.      |..:|.||
 Worm   153 SAVLLSGGHALISVAEDVEKFKLYGQSVSGSPGECIDKVAR--QLGDLGSEFDGIHVGAAVEILA 215

  Fly   185 KSSN-----RY-IKLPYVVKGMDVSFSGILSYIEDLAEPGKRQNKRKKPQEEEVNNYSQADLCYS 243
            ..::     || |.||.|.|. :::|..|.....:|.|      :.:|..|..::   ..|.|.|
 Worm   216 SRASADGHLRYPIFLPNVPKA-NMNFDQIKGSYLNLLE------RLRKNSETSID---IPDFCAS 270

  Fly   244 LQETI-----------FAMLVEITERAMAHCGSNEVLIVGGVGCNERLQEMMRIMCEERGGKLFA 297
            ||.|:           |..|.| .|:.     ..:::|.|||..|:.:...:        .||.|
 Worm   271 LQNTVARHISSKLHIFFESLSE-QEKL-----PKQLVIGGGVAANQYIFGAI--------SKLSA 321

  Fly   298 TDE--------RYCIDNGLMIAHAGAEM 317
            ...        ..|.||..|||::|..|
 Worm   322 AHNVTTIKVLLSLCTDNAEMIAYSGLLM 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs3NP_648880.1 PTZ00340 4..346 CDD:240369 91/351 (26%)
Carbam_trans_N 5..>108 CDD:304575 31/105 (30%)
Med2 <168..231 CDD:288112 19/74 (26%)
C01G10.10NP_506713.1 TsaD 24..350 CDD:223607 91/352 (26%)
Carbam_trans_N 25..>131 CDD:304575 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100288
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.