DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Golgin104 and GOLGA1

DIOPT Version :9

Sequence 1:NP_648879.1 Gene:Golgin104 / 39810 FlyBaseID:FBgn0036614 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_002068.2 Gene:GOLGA1 / 2800 HGNCID:4424 Length:767 Species:Homo sapiens


Alignment Length:720 Identity:166/720 - (23%)
Similarity:285/720 - (39%) Gaps:183/720 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EGLSLRFKDLQAQ-----EKVKELQQTPSQPPQNDILSHVHCLAQLEEQRRNYEQQLEQLRTS-N 146
            :|.|.| :||.:|     |::::|:..               |:...||.||.::..|:|..: .
Human    48 DGSSSR-EDLSSQLLRRNEQIRKLEAR---------------LSDYAEQVRNLQKIKEKLEIALE 96

  Fly   147 VQKDNMITLIQRENAILGKEKQACRKEMEMANKEKEATVIKFAMKEKLLIDAKKEKEAVEKQLAE 211
            ..:|:.:...|.:|            |...||:.|.|..:..|:       |:|::|..|| :.:
Human    97 KHQDSSMRKFQEQN------------ETFQANRAKMAEGLALAL-------ARKDQEWSEK-MDQ 141

  Fly   212 AKKEVKNVSTRFLAVSEEKSRMTYIIDEKCNEVRKY-QRECEKYKTEMGHLESKLKYHINKLNIE 275
            .:|| ||:.|..|...:.:|...:...::.:|:..: |:|..|.|    |:..|.:..:.|:..|
Human   142 LEKE-KNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQELSKIK----HMLLKKEESLGKMEQE 201

  Fly   276 TEAKAVVERKLEEEKNAPNKLEEKANEKLKMEFEANTILLK----HEITSKTEALDKLT---KEQ 333
            .||:.....:.:||....|::....::||: |.:.:...|:    |.|.|||.|..|:|   :::
Human   202 LEARTRELSRTQEELMNSNQMSSDLSQKLE-ELQRHYSTLEEQRDHVIASKTGAESKITALEQKE 265

  Fly   334 QKLSAANKELQNQLQEITTEHNQLTEEYNRLRE----LHNSVEGSYSDELLNSAKLRGQLEELQL 394
            |:|.|..::|...||::|.|..:..:....|:|    |...:|.:.|.|           |.||.
Human   266 QELQALIQQLSIDLQKVTAETQEKEDVITHLQEKVASLEKRLEQNLSGE-----------EHLQE 319

  Fly   395 LRTQNTINEEKLMDQQK------------------RVQKLEALVQDNETDLEQLK-------VKR 434
            |..:.|:.|:.|.|.::                  ||::||..:|.:|..|:|.|       .:.
Human   320 LLKEKTLAEQNLEDTRQQLLAARSSQAKAINTLETRVRELEQTLQASEEQLQQSKGIVAAQETQI 384

  Fly   435 QELLTINKEMSELIVQLQNDICLAK---AKAQGLDAENKLLKQ----EKLTYDTKYNQLEQQLSL 492
            |||...|:|.|.  || |..:.|.:   .:.|.|:|:...|::    ::.|.:....||||:.:.
Human   385 QELAAANQESSH--VQ-QQALALEQQFLERTQALEAQIVALERTRAADQTTAEQGMRQLEQENAA 446

  Fly   493 EASEKNEERLLLAKHLSEKTKMYELTKQKLEDVQGDFEATQHKHATVLKELHRELNKYKRGITEP 557
            ....:||....|..|..|..|:.|...|:        |......|..|:|:.::..:::      
Human   447 LKECRNEYERSLQNHQFELKKLKEEWSQR--------EIVSVAMAQALEEVRKQREEFQ------ 497

  Fly   558 KTPISYCSNCQQAINGYPTENPQQRSHSRSSSHGSMHSGSRRASESSESETVASSATTVQQPPPQ 622
                      |||.|                          ..:...|.|......|.|.....|
Human   498 ----------QQAAN--------------------------LTAIIDEKEQNLREKTEVLLQKEQ 526

  Fly   623 QDLQAVPSKKVLVER-----ILRLQQATARQTERIEFLENHTAALVAEVQKKSKVVQHYMLRDQT 682
            :.||        :||     :|::.|..| :.|.:..|:...||:|||        |..:||  .
Human   527 EILQ--------LERGHNSALLQIHQLQA-ELEALRTLKAEEAAVVAE--------QEDLLR--L 572

  Fly   683 AGALTTSRSDQNKSELVKYGNGIMAAIYGGGSSKTGGENKAMSLELSLEINKKLQAVLEDTLLKN 747
            .|.|.......|:|.:....................||..||.|   .::.|:.|.:.:..|.||
Human   573 RGPLQAEALSVNESHVTSRAMQDPVFQLPTAGRTPNGEVGAMDL---TQLQKEKQDLEQQLLEKN 634

  Fly   748 ITLKE 752
            .|:|:
Human   635 KTIKQ 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Golgin104NP_648879.1 LMBR1 <328..>430 CDD:282625 31/126 (25%)
GOLGA1NP_002068.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..58 5/10 (50%)
SMC_prok_B <121..447 CDD:274008 90/353 (25%)
Smc <249..649 CDD:224117 110/477 (23%)
Grip 692..737 CDD:197860
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..767
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0992
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.