Sequence 1: | NP_648879.1 | Gene: | Golgin104 / 39810 | FlyBaseID: | FBgn0036614 | Length: | 776 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139113.1 | Gene: | SRRM5 / 100170229 | HGNCID: | 37248 | Length: | 715 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 39/202 - (19%) |
---|---|---|---|
Similarity: | 79/202 - (39%) | Gaps: | 45/202 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 QAQEKVKELQQTPSQPPQNDILSHVHCLAQLEEQRR----NYEQQLEQLRTSNVQKDNMITLIQR 158
Fly 159 ENAILGKEKQACRKEMEMANKEKEATVIKFAMKEKLLIDAKKEKEAVEKQLAEAKKEVKNVSTRF 223
Fly 224 LAVSEEKSRMTYIIDEKCNEVRKYQRECEKYKTEMGHLESKLKYHINKLNIETEAKAVVERKLEE 288
Fly 289 EKNAPNK 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Golgin104 | NP_648879.1 | LMBR1 | <328..>430 | CDD:282625 | |
SRRM5 | NP_001139113.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..715 | 39/202 (19%) | |
PHA03328 | 498..>554 | CDD:223046 | 16/72 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |