DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS34 and Mrps34

DIOPT Version :9

Sequence 1:NP_524104.2 Gene:mRpS34 / 39809 FlyBaseID:FBgn0285951 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_075749.1 Gene:Mrps34 / 79044 MGIID:1930188 Length:218 Species:Mus musculus


Alignment Length:165 Identity:44/165 - (26%)
Similarity:76/165 - (46%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RGNTLWELVSNLPNWGVGRLLIR-NMFQRYPEPCYMRILKVQSVDEQPGEIRKVRVTVEKTWRGV 79
            |.:.|.:|::.||.:|:|||:.| :...::.||||.|:.:|:. |.....:...|.....|::|.
Mouse    60 RESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRP-DYTAQNLDHGRAWGILTFKGK 123

  Fly    80 TQPKPVEIYSTSYKADYELVPQDQEAKYLNNKKKVEPVILPTKIELPPLLRELVSEETGNPNPQM 144
            ::....||....|. |:.|||:.:|..:.....|.|..:  ..:..|||||.::..|. ..|...
Mouse   124 SEDTAREIEQVMYH-DWRLVPKHEEEAFTAFTAKPEDRL--NSVPYPPLLRAMILAER-QKNGDT 184

  Fly   145 KVHYKLTDNKMARLAKDGEKPTVNFALGVGQPKPV 179
            .|...|.:.:..|: :..:.|......|..:..||
Mouse   185 SVQEPLLNLERTRM-RPWDYPAKQETKGRAKGTPV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS34NP_524104.2 MRP-S34 17..136 CDD:292671 34/119 (29%)
Mrps34NP_075749.1 MRP-S34 74..185 CDD:292671 32/115 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837994
Domainoid 1 1.000 47 1.000 Domainoid score I11987
eggNOG 1 0.900 - - E1_28K3H
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107021
Panther 1 1.100 - - LDO PTHR28589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3868
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.