DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS34 and mrps34

DIOPT Version :9

Sequence 1:NP_524104.2 Gene:mRpS34 / 39809 FlyBaseID:FBgn0285951 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001004910.2 Gene:mrps34 / 448272 XenbaseID:XB-GENE-999204 Length:215 Species:Xenopus tropicalis


Alignment Length:171 Identity:45/171 - (26%)
Similarity:73/171 - (42%) Gaps:52/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LWELVSNLPNWGVGRLLIR-NMFQRYPEPCYMRILKVQSVDEQPGEIRKVRVTVE-----KTW-- 76
            |:.|::.|.::|:||::.| :..::|.||||..|.||           ||..|.|     |.|  
 Frog    63 LFTLLTGLRSFGIGRVVTRKSWLEQYDEPCYWTITKV-----------KVDYTAENMDHGKAWGY 116

  Fly    77 ---RGVTQPKPVEIYSTSYKADYELVPQDQEAKYLNNKKKVEPVILPTKIE---LPPLLRELVSE 135
               ||..:.:..||....|. |:.:||:.:|    .|.|...||..|..:.   .|||:|.::  
 Frog   117 LTFRGKPENEVKEIPKVMYH-DWRIVPRHEE----ENFKSFTPVPEPEPVRYVPYPPLMRAMI-- 174

  Fly   136 ETGNPNPQMKVHYKLTDNKMARLAKDGEKPTVNFALGVGQP 176
                               :|::.|:| ||.....:.:.:|
 Frog   175 -------------------LAQMQKEG-KPLTEPMIDLQRP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS34NP_524104.2 MRP-S34 17..136 CDD:292671 39/129 (30%)
mrps34NP_001004910.2 MRP-S34 60..187 CDD:374331 44/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11767
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5286
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1475824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3868
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.090

Return to query results.
Submit another query.