DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS34 and Mrps34

DIOPT Version :9

Sequence 1:NP_524104.2 Gene:mRpS34 / 39809 FlyBaseID:FBgn0285951 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001099241.1 Gene:Mrps34 / 287126 RGDID:1305623 Length:218 Species:Rattus norvegicus


Alignment Length:165 Identity:44/165 - (26%)
Similarity:76/165 - (46%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RGNTLWELVSNLPNWGVGRLLIR-NMFQRYPEPCYMRILKVQSVDEQPGEIRKVRVTVEKTWRGV 79
            |.:.|.:|::.||.:|:|||:.| :...::.||||.|:.:|:. |.....:...|.....|::|.
  Rat    60 RESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRP-DYTAQNLDHGRAWGILTFKGK 123

  Fly    80 TQPKPVEIYSTSYKADYELVPQDQEAKYLNNKKKVEPVILPTKIELPPLLRELVSEETGNPNPQM 144
            ::....||....|. |:.|||:.:|..:.....|.|..:  ..:..|||||.::..|. ..|...
  Rat   124 SEETAREIEQVMYH-DWRLVPKHEEEAFTAFTGKAEDRL--NLVPYPPLLRAMILAER-QKNGDT 184

  Fly   145 KVHYKLTDNKMARLAKDGEKPTVNFALGVGQPKPV 179
            .|...|.:.:..|: :..:.|......|..:..||
  Rat   185 SVEEPLLNLERTRM-RPWDYPAKQETKGRAKGTPV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS34NP_524104.2 MRP-S34 17..136 CDD:292671 34/119 (29%)
Mrps34NP_001099241.1 MRP-S34 74..187 CDD:406457 32/117 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341773
Domainoid 1 1.000 47 1.000 Domainoid score I11711
eggNOG 1 0.900 - - E1_28K3H
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1475824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107021
Panther 1 1.100 - - LDO PTHR28589
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.