DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG34436

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:276 Identity:73/276 - (26%)
Similarity:112/276 - (40%) Gaps:59/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   924 RNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQNG 988
            :|.|.:: |:.|.:..       ..||...:|.  |.::   |.|.||....:|::|.|:.:|. 
  Fly    25 QNCAEVS-RLSNDIIF-------SRPWMALVLL--PNKT---CSGALIHKYFVITSASCVFNQE- 75

  Fly   989 FDLRVRLGEWDVNHDVEFFPYIERD--VVSVHIHPEYYAGTLDNDLAVLKLDQPVDFTKNPHISP 1051
             ...||||:..:..: ....|...|  |.|.:||..|.....::|:|:|:|..  |.....||.|
  Fly    76 -RAIVRLGQLSIKQE-HIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQN--DVLYKAHIRP 136

  Fly  1052 ACLPDKYSDFTG---ARCWTTGWGKDAFGEHGKYQNIL---KEVDVPILSHQQCESQLRNTRLGY 1110
            .||....||...   .|..|..||.|.     ||  ||   |...:..:|..:||:         
  Fly   137 ICLWLDKSDIDTQMFKRYETFRWGIDE-----KY--ILPAAKTSKIKHISQVKCEN--------- 185

  Fly  1111 SYKLNP--GFVCAGGEEGKDACKGDGGGPLVCDRNGAMHV----VGVVSWGIG--CGQVNVPGVY 1167
            ::||.|  ..:|| |.:.|..|. :.|.||.........:    .|:.|:|..  |       :|
  Fly   186 AFKLYPQNSHICA-GYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC-------LY 241

  Fly  1168 VKVSAYLPWIQQITQS 1183
            ..|:.|:.||..:.|:
  Fly   242 TDVTKYIDWIMGVIQN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 68/253 (27%)
Tryp_SPc 942..1177 CDD:214473 66/250 (26%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 67/246 (27%)
Tryp_SPc 40..251 CDD:214473 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.