DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG34290

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:272 Identity:75/272 - (27%)
Similarity:126/272 - (46%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   929 ITGRIKNPVYVDGDSEFGEYPWHVA---ILKKDPKESI---YACGGTLIDAQHIISAAHCIKSQN 987
            :.|||.:.|    .|...:||:.|:   ::.::....:   :.|||:||..:.|:|||||:..:|
  Fly    35 VGGRIVSTV----GSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKN 95

  Fly   988 GFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLDNDLAVLKLDQPV--DFTKN---- 1046
            ...:...:|..::.:..:..||....|..::..|..:.    ||:|:|.:.:..  ||...    
  Fly    96 IHYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFR----NDIALLYMKRRYWSDFGNGLQYA 156

  Fly  1047 ---PHISPACLPDKYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRL 1108
               ||   ...||:     ...|...|:|  |....|..|..|.|.:|.::.:|:|..     .:
  Fly   157 QLPPH---GMKPDQ-----NESCRIIGYG--ATHHAGPCQKRLFEAEVRVIDNQKCRD-----II 206

  Fly  1109 GYSYKLNPG--FVCAGGEEGKDACKGDGGGPLVCDRNGAMHVVGVVSWGIGCGQVNVPGVYVKVS 1171
            |:.:....|  .|||.| ..:|:|:||.||||:|...|..::.|:||.|:.||...:|.:|....
  Fly   207 GHIWAPQNGANTVCALG-NNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTR 270

  Fly  1172 AYLPWIQQITQS 1183
            .|..|:|.:.||
  Fly   271 PYYDWVQLLMQS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 69/254 (27%)
Tryp_SPc 942..1177 CDD:214473 67/251 (27%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 72/265 (27%)
Tryp_SPc 34..276 CDD:214473 71/264 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.