DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG34437

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:259 Identity:67/259 - (25%)
Similarity:105/259 - (40%) Gaps:79/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   945 FGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQNGFDLRVRLGEWDVNHDVEFFPY 1009
            |.|.|| :|.:....|.    |.||||:.|::|:.|.|:..|:  :..|.||.:| |.......|
  Fly    37 FKETPW-MAFIASPTKN----CSGTLINKQYVITTASCVFDQS--ESTVFLGRFD-NIPQNRNRY 93

  Fly  1010 IERDVVSVHIHPEYYAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGARCW------- 1067
            ::..|.||:.|..|...|.::|:|:|.||.||.|..:  |.|.|:            |       
  Fly    94 VKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMS--IQPICI------------WLGEITNL 144

  Fly  1068 ----TTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKD 1128
                :..||   ..|...:|.|   ..|.||..::|       |..:...|....:|||.:.|. 
  Fly   145 NHLESNRWG---LSEKMIFQRI---NTVKILKIKKC-------RDSFGITLKKSQICAGFQNGN- 195

  Fly  1129 ACKGDGGGPLVCDRNGA-----MH--------VVGVVSWGIG--CGQVNVPGVYVKVSAYLPWI 1177
                      :|...|:     :|        ::|:.|:|:.  |       :|.|::.|:.||
  Fly   196 ----------ICTETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 67/259 (26%)
Tryp_SPc 942..1177 CDD:214473 65/257 (25%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 64/255 (25%)
Tryp_SPc 39..242 CDD:304450 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.