DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG12951

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:268 Identity:82/268 - (30%)
Similarity:130/268 - (48%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   923 VRNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQN 987
            |..||....|:.|..    ||...:||:.|::...|...|   |||::|....:::||||...:.
  Fly    20 VGQAAPSISRVVNGT----DSSVLKYPFVVSLRSYDGSHS---CGGSIISKHFVMTAAHCTNGRP 77

  Fly   988 GFDLRVRLGEWDVNHDVEFFPYIERDVVSVH--IHPEYYAGTLD--NDLAVLKLDQPVDFTKNPH 1048
            ...|.::.|..:::       .:..:||.:.  |..|.:..|..  ||:::|.:::|.:| ....
  Fly    78 ADTLSIQFGVTNIS-------AMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEF-DGVS 134

  Fly  1049 ISPACLPD-----KYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRL 1108
            ::|..||.     ..|| .|......|||.:  ..:|..|:.|:||.:.|.|.::|.|:      
  Fly   135 VAPVELPALAFAVPQSD-AGVEGVLIGWGLN--DTYGSVQDTLQEVSLKIYSDEECTSR------ 190

  Fly  1109 GYSYKLNPGF-VCAGGEE-GKDACKGDGGGPLVCDRNGAMHVVGVVSWGI-GCGQVNVPGVYVKV 1170
             ::.:.:|.: :|.|.:| ||..|.||.||||:  .||..  ||:|||.| .|.....||||.||
  Fly   191 -HNGQTDPKYHICGGVDEGGKGQCSGDSGGPLI--YNGQQ--VGIVSWSIKPCTVAPYPGVYCKV 250

  Fly  1171 SAYLPWIQ 1178
            |.|:.||:
  Fly   251 SQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 77/249 (31%)
Tryp_SPc 942..1177 CDD:214473 75/246 (30%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 77/256 (30%)
Tryp_SPc 30..260 CDD:238113 78/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.