DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG3700

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:334 Identity:101/334 - (30%)
Similarity:148/334 - (44%) Gaps:87/334 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   882 PKEQRAYYGNRPVEKTCR-INEVCCRRPLRPQAPPQQFGRCGVRNAAGITGRIKNPVYVDGDSEF 945
            |.||     .||.||.|: .||                    ||:|...|     |..|.|....
  Fly    75 PAEQ-----TRPFEKQCKQYNE--------------------VRSACQST-----PFIVGGTKAS 109

  Fly   946 G-EYPWHVAILKKDPKES----IYACGGTLIDAQHIISAAHCIKSQN--------GFD---LRVR 994
            | |:|:...|....|.:|    .:.|||:::..:.:::||||:::..        .||   ..||
  Fly   110 GKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVR 174

  Fly   995 LGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLD------NDLAVLKLDQPVDFTKNPHISPAC 1053
            |||.|.|...:.....:..||:..:||.|  .|.|      ||:|:::||:..:|  |.|::..|
  Fly   175 LGELDYNSTTDDALVQDFRVVNYVVHPGY--DTEDEEQGFKNDIALVELDRKAEF--NDHVAAVC 235

  Fly  1054 L-PDKYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLR---NTRLGYSYKL 1114
            | ||..:|.  .:....|||..|.|.  |..::|| |::...|.:.|:.:||   :||..:    
  Fly   236 LPPDSGNDV--QQVTAAGWGFTADGV--KSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQF---- 291

  Fly  1115 NPGFVCAGGEEGK-DACKGDGGGPLV-------CDRNGAMHVVGVVSWGIGCGQVNVPGVYVKVS 1171
                 |||....: |.|.||.|||:.       |    ...|:|:||:|:.||...:|.||.||.
  Fly   292 -----CAGSMSSQADTCNGDSGGPIFVQHPLYPC----LKQVIGIVSYGLVCGSQGLPSVYTKVH 347

  Fly  1172 AYLPWIQQI 1180
            .|..||:.|
  Fly   348 LYTDWIESI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 83/271 (31%)
Tryp_SPc 942..1177 CDD:214473 81/268 (30%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/275 (31%)
Tryp_SPc 102..353 CDD:214473 83/272 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.