DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG4793

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:338 Identity:100/338 - (29%)
Similarity:153/338 - (45%) Gaps:47/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   865 RDRRRRSVEDGVWAGAAPKEQRAYYGNRPV---------EKTCRINEVCCRRPLRPQAPPQQFGR 920
            |:|.|...|.|                ||:         .:.|...:.||.:....|.|.|...:
  Fly    32 RNRCRIGTETG----------------RPIIDFRGLNNGNQGCESGQTCCPKTEILQYPVQADNQ 80

  Fly   921 -----CGVRNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHII-SA 979
                 ||..|..|:...|.|...:   ::.||.||.||:|  |.:..:...||:||....:: |:
  Fly    81 PLPTECGHVNRIGVGFTITNARDI---AQKGELPWMVALL--DSRSRLPLGGGSLITRDVVLTSS 140

  Fly   980 AHCIKSQNGFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLDNDLAVLKLDQPVDFT 1044
            ...::....: |.||.||||.....|...:.:..:..:..|.........|:.|:|.|.:|:.. 
  Fly   141 TKTLEVPEKY-LIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKL- 203

  Fly  1045 KNPHISPACLPDKYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLG 1109
             :.||...|||....:|...||..:||||....:: .|.||||::::|::....|:::|:.. .|
  Fly   204 -DHHIGLICLPPPNRNFIHNRCIVSGWGKKTALDN-SYMNILKKIELPLVDRSVCQTKLQGP-YG 265

  Fly  1110 YSYKLNPGFVCAGGEEGKDACKGDGGGPLVC----DRNGAMHVVGVVSWGIGCGQVNVPGVYVKV 1170
            ..:.|:...:|||||.|||.||||||.||.|    |.| ...::|:|::|.|||. .:|..|..|
  Fly   266 KDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPN-RYELLGIVNFGFGCGG-PLPAAYTDV 328

  Fly  1171 SAYLPWIQQITQS 1183
            |....||....|:
  Fly   329 SQIRSWIDNCIQA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 80/242 (33%)
Tryp_SPc 942..1177 CDD:214473 78/239 (33%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 80/240 (33%)
Tryp_SPc 105..335 CDD:214473 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.