DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG18477

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:297 Identity:100/297 - (33%)
Similarity:152/297 - (51%) Gaps:25/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   898 CRINEVCCRRPL----------RPQAPPQQFGRCGVRNAAGITGRIKNPVYVDGDSEFGEYPWHV 952
            |....:||.:.|          .|...||    ||..|:.|:|...:..  ..|.::..|.||.|
  Fly    64 CVSTAICCPKNLIIKEPRLIINEPITDPQ----CGFVNSKGVTFSFREE--DTGLAQEAEVPWMV 122

  Fly   953 AILKKDPKESIYACGGTLIDAQHIISAAHCIKSQNGFDLRVRLGEWDVNHDVEFFPYIERDVVSV 1017
            |:|  |.:.|.|..||.||....:|:|....::.....|.||.||||.:...|..|.::..:.|:
  Fly   123 ALL--DARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSI 185

  Fly  1018 HIHPEYYAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGARCWTTGWGKDAFGEHGKY 1082
            ..||.:......|::|::.|.:  ..|.:.||:|.|:|....:|..:||..|||||::| :...|
  Fly   186 VRHPGFNLENGANNVALVFLRR--SLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSF-DDPSY 247

  Fly  1083 QNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVC---DRNG 1144
            .|:||::.:|::..:.||.||| ...|..::|:...:|||||.|||:|:||||.||.|   |...
  Fly   248 MNVLKKISLPVVQRRTCEQQLR-LYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQ 311

  Fly  1145 AMHVVGVVSWGIGCGQVNVPGVYVKVSAYLPWIQQIT 1181
            ...:.|:|::|:.||...||.||..|:..:.||...|
  Fly   312 RYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 86/240 (36%)
Tryp_SPc 942..1177 CDD:214473 84/237 (35%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 84/236 (36%)
Tryp_SPc 113..344 CDD:238113 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.